Mouse Hao1 protein

Catalog Number: BYT-ORB383074
Article Name: Mouse Hao1 protein
Biozol Catalog Number: BYT-ORB383074
Supplier Catalog Number: orb383074
Alternative Catalog Number: BYT-ORB383074-20,BYT-ORB383074-100,BYT-ORB383074-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Short name, HAOX1 Alternative name(s), Glycolate oxidase Short name, GOX
This Mouse Hao1 protein spans the amino acid sequence from region 1-370aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 45 kDa
UniProt: Q9WU19
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mus musculus (Mouse)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MLPRLVCISDYEQHVRSVLQKSVYDYYRSGANDQETLADNIQAFSRWKLYPRMLRNVADIDLSTSVLGQRVSMPICVGATAMQCMAHVDGELATVRACQTMGTGMMLSSWATSSIEEVAEAGPEALRWMQLYIYKDREISRQIVKRAEKQGYKAIFVTVDTPYLGNRIDDVRNRFKLPPQLRMKNFETNDLAFSPKGNFGDNSGLAEYVAQAIDPSLSWDDITWLRRLTSLPIVVKGILRGDDAKEAVKHGVDGI
Application Notes: Biological Origin: Mus musculus (Mouse). Application Notes: E.coli and Yeast N-terminal 6xHis-tagged Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.