Mouse DME protein

Catalog Number: BYT-ORB383080
Article Name: Mouse DME protein
Biozol Catalog Number: BYT-ORB383080
Supplier Catalog Number: orb383080
Alternative Catalog Number: BYT-ORB383080-20,BYT-ORB383080-100,BYT-ORB383080-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: DNA glycosylase-related protein DME
This Mouse DME protein spans the amino acid sequence from region 1-320aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 51.4 kDa
UniProt: Q8LK56
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Arabidopsis thaliana (Mouse-ear cress)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MNSRADPGDRYFRVPLENQTQQEFMGSWIPFTPKKPRSSLMVDERVINQDLNGFPGGEFVDRGFCNTGVDHNGVFDHGAHQGVTNLSMMINSLAGSHAQAWSNSERDLLGRSEVTSPLAPVIRNTTGNVEPVNGNFTSDVGMVNGPFTQSGTSQAGYNEFELDDLLNPDQMPFSFTSLLSGGDSLFKVRQYGPPACNKPLYNLNSPIRREAVGSVCESSFQYVPSTPSLFRTGEKTGFLEQIVTTTGHEIPEPKS
Application Notes: Biological Origin: Arabidopsis thaliana (Mouse-ear cress). Application Notes: E.coli and Yeast N-terminal 6xHis-SUMO-tagged Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.