Mouse Sigirr protein

Catalog Number: BYT-ORB383088
Article Name: Mouse Sigirr protein
Biozol Catalog Number: BYT-ORB383088
Supplier Catalog Number: orb383088
Alternative Catalog Number: BYT-ORB383088-20,BYT-ORB383088-100,BYT-ORB383088-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Single Ig IL-1R-related molecule Single immunoglobulin domain-containing IL1R-related protein Toll/interleukin-1 receptor 8 Short name, TIR8
This Mouse Sigirr protein spans the amino acid sequence from region 1-117aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 28.7 kDa
UniProt: Q9JLZ8
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mus musculus (Mouse)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MAGVCDMAPNFLSPSEDQALGLALGREVALNCTAWVFSRPQCPQPSVQWLKDGLALGNGSHFSLHEDFWVSANFSEIVSSVLVLNLTNAEDYGTFTCSVWNVSSHSFTLWRAGPAGH
Application Notes: Biological Origin: Mus musculus (Mouse). Application Notes: E.coli and Yeast N-terminal 6xHis-SUMO-tagged Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.