Viral NP protein

Catalog Number: BYT-ORB383097
Article Name: Viral NP protein
Biozol Catalog Number: BYT-ORB383097
Supplier Catalog Number: orb383097
Alternative Catalog Number: BYT-ORB383097-20,BYT-ORB383097-100,BYT-ORB383097-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Nucleocapsid protein Short name, Protein N
This Viral NP protein spans the amino acid sequence from region 1-498aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 72.2 kDa
UniProt: P15682
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Influenza A virus (strain A/Wilson-Smith/1933 H1N1)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MATKGTKRSYEQMETDGERQNATEIRASVGKMIGGIGRFYIQMCTELKLSDYEGRLIQNSLTIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVDGKWMRELILYDKEEIRRIWRQANNGDDATAGLTHMMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGVGTMVMELIRMIKRGINDRNFWRGENGRRTRIAYERMCNILKGKFQTAAQRAMVDQVRESRNPGNAEFED
Application Notes: Biological Origin: Influenza A virus (strain A/Wilson-Smith/1933 H1N1). Application Notes: E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Influenza A virus (strain A/Wilson-Smith/1933 H1N1) NP.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Influenza A virus (strain A/Wilson-Smith/1933 H1N1) NP.