Viral T4 Lysozyme protein
Catalog Number:
BYT-ORB383100
- Images (3)
| Article Name: | Viral T4 Lysozyme protein |
| Biozol Catalog Number: | BYT-ORB383100 |
| Supplier Catalog Number: | orb383100 |
| Alternative Catalog Number: | BYT-ORB383100-20,BYT-ORB383100-100,BYT-ORB383100-1 |
| Manufacturer: | Biorbyt |
| Category: | Proteine/Peptide |
| Alternative Names: | Lysis protein Lysozyme Muramidase |
| This Viral T4 Lysozyme protein spans the amino acid sequence from region 1-164aa. Purity: Greater than 90% as determined by SDS-PAGE. |
| Molecular Weight: | 34.6 kDa |
| UniProt: | P00720 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Enterobacteria phage T4 (Bacteriophage T4) |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MNIFEMLRIDERLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNCNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRCALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSIWYNQTPNRAKRVITTFRTGTWDAYKNL |
| Application Notes: | Biological Origin: Enterobacteria phage T4 (Bacteriophage T4). Application Notes: E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length |



