Dog MMP13 protein

Catalog Number: BYT-ORB383104
Article Name: Dog MMP13 protein
Biozol Catalog Number: BYT-ORB383104
Supplier Catalog Number: orb383104
Alternative Catalog Number: BYT-ORB383104-20,BYT-ORB383104-100,BYT-ORB383104-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: /
This Dog MMP13 protein spans the amino acid sequence from region 28-478aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 67.5 kDa
UniProt: A0A0C6E3R7
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Canis lupus familiaris (Dog) (Canis familiaris)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: LPLPSDGDDDLSEEDFQLAERYLKSYYYPLNPAGILKKSAAGSVADRLREMQSFFGLEVTGKLDDNTLDIMKKPRCGVPDVGEYNVFPRTLKWSKTNLTYRIVNYTPDLTHSEVEKAFKKAFKVWSDVTPLNFTRLHDGTADIMISFGTKEHGDFYPFDGPSGLLAHAFPPGPNYGGDAHFDDDETWTSSSKGYNLFLVAAHEFGHSLGLDHSKDPGALMFPIYTYTGKSHFMLPDDDVQGIQSLYGPGDEDPNP
Application Notes: Biological Origin: Canis lupus familiaris (Dog) (Canis familiaris). Application Notes: E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.