Pig UOX protein

Catalog Number: BYT-ORB383106
Article Name: Pig UOX protein
Biozol Catalog Number: BYT-ORB383106
Supplier Catalog Number: orb383106
Alternative Catalog Number: BYT-ORB383106-20,BYT-ORB383106-100,BYT-ORB383106-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Urate oxidase
This Pig UOX protein spans the amino acid sequence from region 1-304aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 51 kDa
UniProt: P16164
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Sus scrofa (Pig)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MAHYRNDYKKNDEVEFVRTGYGKDMIKVLHIQRDGKYHSIKEVATSVQLTLSSKKDYLHGDNSDVIPTDTIKNTVNVLAKFKGIKSIETFAVTICEHFLSSFKHVIRAQVYVEEVPWKRFEKNGVKHVHAFIYTPTGTHFCEVEQIRNGPPVIHSGIKDLKVLKTTQSGFEGFIKDQFTTLPEVKDRCFATQVYCKWRYHQGRDVDFEATWDTVRSIVLQKFAGPYDKGEYSPSVQKTLYDIQVLTLGQVPEIED
Application Notes: Biological Origin: Sus scrofa (Pig). Application Notes: E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.