Viral IX protein

Catalog Number: BYT-ORB383111
Article Name: Viral IX protein
Biozol Catalog Number: BYT-ORB383111
Supplier Catalog Number: orb383111
Alternative Catalog Number: BYT-ORB383111-20,BYT-ORB383111-100,BYT-ORB383111-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Coat protein C, polypeptide II G9P
This Viral IX protein spans the amino acid sequence from region 1-32aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 19.7 kDa
UniProt: P69538
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Enterobacteria phage M13 (Bacteriophage M13)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MSVLVYSFASFVLGWCLRSGITYFTRLMETSS
Application Notes: Biological Origin: Enterobacteria phage M13 (Bacteriophage M13). Application Notes: E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.