Plant Isoallergen 1 protein

Catalog Number: BYT-ORB383115
Article Name: Plant Isoallergen 1 protein
Biozol Catalog Number: BYT-ORB383115
Supplier Catalog Number: orb383115
Alternative Catalog Number: BYT-ORB383115-20,BYT-ORB383115-100,BYT-ORB383115-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Allergen Api g 1.0101 Allergen Api g I Allergen, Api g 1
This Plant Isoallergen 1 protein spans the amino acid sequence from region 1-154aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 18.3 kDa
UniProt: P49372
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Apium graveolens (Celery)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEIKGDGGPGTLKIITLPDGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAIFHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN
Application Notes: Biological Origin: Apium graveolens (Celery). Application Notes: E.coli and Yeast N-terminal 6xHis-tagged Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.