Human DEFB130 protein

Catalog Number: BYT-ORB383119
Article Name: Human DEFB130 protein
Biozol Catalog Number: BYT-ORB383119
Supplier Catalog Number: orb383119
Alternative Catalog Number: BYT-ORB383119-20,BYT-ORB383119-100,BYT-ORB383119-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Beta-defensin 30 Short name, DEFB-30 Defensin, beta 130
This Human DEFB130 protein spans the amino acid sequence from region 23-79aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 8.3 kDa
UniProt: Q30KQ2
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: GVIPGQKQCIALKGVCRDKLCSTLDDTIGICNEGKKCCRRWWILEPYPTPVPKGKSP
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: E.coli and Yeast N-terminal 6xHis-tagged Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.