Mouse Lgals4 protein

Catalog Number: BYT-ORB383124
Article Name: Mouse Lgals4 protein
Biozol Catalog Number: BYT-ORB383124
Supplier Catalog Number: orb383124
Alternative Catalog Number: BYT-ORB383124-20,BYT-ORB383124-100,BYT-ORB383124-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Gal-4 Alternative name(s), Lactose-binding lectin 4
This Mouse Lgals4 protein spans the amino acid sequence from region 1-326aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 38.4 kDa
UniProt: Q8K419
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mus musculus (Mouse)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MAYVPAPGYQPTYNPTLPYKRPIPGGLSVGMSVYIQGMAKENMRRFHVNFAVGQDDGADVAFHFNPRFDGWDKVVFNTMQSGQWGKEEKKKSMPFQKGKHFELVFMVMPEHYKVVVNGNSFYEYGHRLPVQMVTHLQVDGDLELQSINFLGGQPAAAPYPGAMTIPAYPAGSPGYNPPQMNTLPVMTGPPVFNPRVPYVGALQGGLTVRRTIIIKGYVLPTARNFVINFKVGSSGDIALHLNPRIGDSVVRNSFM
Application Notes: Biological Origin: Mus musculus (Mouse). Application Notes: E.coli and Yeast N-terminal 6xHis-tagged Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.