Plant Major pollen allergen Aln g 1 protein

Catalog Number: BYT-ORB383129
Article Name: Plant Major pollen allergen Aln g 1 protein
Biozol Catalog Number: BYT-ORB383129
Supplier Catalog Number: orb383129
Alternative Catalog Number: BYT-ORB383129-20,BYT-ORB383129-100,BYT-ORB383129-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Allergen Aln g I Allergen, Aln g 1
This Plant Major pollen allergen Aln g 1 protein spans the amino acid sequence from region 2-160aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 19.2 kDa
UniProt: P38948
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: European alder
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: GVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGPGTIKKITFPEGSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVCNEIKIVAAPDGGSILKISNKFHTKGDHEINAEQIKIEKEKAVGLLKAVESYLLAHSDAYN
Application Notes: Biological Origin: European alder. Application Notes: E.coli and Yeast N-terminal 6xHis-tagged Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.