Human RETNLB protein

Catalog Number: BYT-ORB383136
Article Name: Human RETNLB protein
Biozol Catalog Number: BYT-ORB383136
Supplier Catalog Number: orb383136
Alternative Catalog Number: BYT-ORB383136-20,BYT-ORB383136-100,BYT-ORB383136-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Colon and small intestine-specific cysteine-rich protein Colon carcinoma-related gene protein Cysteine-rich secreted protein A12-alpha-like 1 Cysteine-rich secreted protein FIZZ2 RELMbeta
This Human RETNLB protein spans the amino acid sequence from region 24-111aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 13.4 kDa
UniProt: Q9BQ08
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: QCSLDSVMDKKIKDVLNSLEYSPSPISKKLSCASVKSQGRPSSCPAGMAVTGCACGYGCGSWDVQLETTCHCQCSVVDWTTARCCHLT
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: E.coli and Yeast N-terminal 6xHis-tagged Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.