Bacterial yopM protein

Catalog Number: BYT-ORB383144
Article Name: Bacterial yopM protein
Biozol Catalog Number: BYT-ORB383144
Supplier Catalog Number: orb383144
Alternative Catalog Number: BYT-ORB383144-20,BYT-ORB383144-100,BYT-ORB383144-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: yopM, yop48, YPCD1.26c, y5054, y0059, YP_pCD60, Outer membrane protein YopM
This Bacterial yopM protein spans the amino acid sequence from region 1-409aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 62.2 kDa
UniProt: P17778
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Yersinia pestis
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MFINPRNVSNTFLQEPLRHSSNLTEMPVEAENVKSKTEYYNAWSEWERNAPPGNGEQREMAVSRLRDCLDRQAHELELNNLGLSSLPELPPHLESLVASCNSLTELPELPQSLKSLLVDNNNLKALSDLPPLLEYLGVSNNQLEKLPELQNSSFLKIIDVDNNSLKKLPDLPPSLEFIAAGNNQLEELPELQNLPFLTAIYADNNSLKKLPDLPLSLESIVAGNNILEELPELQNLPFLTTIYADNNLLKTLPDL
Application Notes: Biological Origin: Yersinia pestis. Application Notes: E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.