Mouse CD3E protein

Catalog Number: BYT-ORB383173
Article Name: Mouse CD3E protein
Biozol Catalog Number: BYT-ORB383173
Supplier Catalog Number: orb383173
Alternative Catalog Number: BYT-ORB383173-20,BYT-ORB383173-100,BYT-ORB383173-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: FLJ18683 Proteins, T3E Proteins, TCRE Proteins, CD3E Proteins, CD3-epsilon Proteins, CD3 epsilon Proteins, CD3E Proteins, CD3E antigen epsilon polypeptide (TiT3 complex) Proteins, CD3E antigen epsilon polypeptide Proteins, CD3E antigen Proteins, epsilon subunit Proteins, CD3E molecule epsilon Proteins, CD3E molecule Proteins, epsilon (CD3 TCR complex) Proteins, CD3E molecule Proteins, epsilon (CD3-TCR complex) Proteins, CD3E_HUMAN Proteins, IMD18 Proteins, T cell antigen receptor complex epsilon subunit of T3 Proteins, T cell surface antigen T3/Leu 4 epsilon chain Proteins, T cell surface glycoprotein CD3 epsilon chain Proteins, T-cell surface antigen T3/Leu-4 epsilon chain Proteins, T-cell surface glycoprotein CD3 epsilon chain Proteins, T3E Proteins, TCRE Proteins
This Mouse CD3E protein spans the amino acid sequence from region 23-108aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 11.9 kDa
UniProt: P22646
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mus musculus (Mouse)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: DAENIEYKVSISGTSVELTCPLDSDENLKWEKNGQELPQKHDKHLVLQDFSEVEDSGYYVCYTPASNKNTYLYLKARVCEYCVEVD
Application Notes: Biological Origin: Mus musculus (Mouse). Application Notes: E.coli and Yeast N-terminal 6xHis-tagged Extracellular Domain
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Mus musculus (Mouse) Cd3e.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Mus musculus (Mouse) Cd3e.