Human IZUMO1R protein

Catalog Number: BYT-ORB383189
Article Name: Human IZUMO1R protein
Biozol Catalog Number: BYT-ORB383189
Supplier Catalog Number: orb383189
Alternative Catalog Number: BYT-ORB383189-20,BYT-ORB383189-100,BYT-ORB383189-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Folate receptor 4 Folate receptor delta Short name, FR-delta IZUMO1 receptor protein JUNO
This Human IZUMO1R protein spans the amino acid sequence from region 20-250aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 30.3 kDa
UniProt: A6ND01
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: GDELLNICMNAKHHKRVPSPEDKLYEECIPWKDNACCTLTTSWEAHLDVSPLYNFSLFHCGLLMPGCRKHFIQAICFYECSPNLGPWIQPVGSLGWEVAPSGQGERVVNVPLCQEDCEEWWEDCRMSYTCKSNWRGGWDWSQGKNRCPKGAQCLPFSHYFPTPADLCEKTWSNSFKASPERRNSGRCLQKWFEPAQGNPNVAVARLFASSAPSWELSYTIMVCSLFLPFLS
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: E.coli and Yeast N-terminal 6xHis-tagged Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) IZUMO1R.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) IZUMO1R.