Bacterial mrkA protein
Catalog Number:
BYT-ORB383305
- Images (3)
| Article Name: | Bacterial mrkA protein |
| Biozol Catalog Number: | BYT-ORB383305 |
| Supplier Catalog Number: | orb383305 |
| Alternative Catalog Number: | BYT-ORB383305-20,BYT-ORB383305-100,BYT-ORB383305-1 |
| Manufacturer: | Biorbyt |
| Category: | Proteine/Peptide |
| Alternative Names: | mrkAFimbrial subunit type 3 |
| This Bacterial mrkA protein spans the amino acid sequence from region 23-202aa. Purity: Greater than 90% as determined by SDS-PAGE. |
| Molecular Weight: | 34.5 kDa |
| UniProt: | P12267 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Klebsiella pneumoniae |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | ADTNVGGGQVNFFGKVTDVSCTVSVNGQGSDANVYLSPVTLTEVKAAAADTYLKPKSFTIDVSDCQAADGTKQDDVSKLGVNWTGGNLLAGATAKQQGYLANTEAAGAQNIQLVLSTDNATALTNKIIPGDSTQPKAAGDASAVQDGARFTYYVGYATSTPTTVTTGVVNSYATYEITYQ |
| Application Notes: | Biological Origin: Klebsiella pneumoniae |



