Bacterial mrkA protein

Catalog Number: BYT-ORB383305
Article Name: Bacterial mrkA protein
Biozol Catalog Number: BYT-ORB383305
Supplier Catalog Number: orb383305
Alternative Catalog Number: BYT-ORB383305-20,BYT-ORB383305-100,BYT-ORB383305-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: mrkAFimbrial subunit type 3
This Bacterial mrkA protein spans the amino acid sequence from region 23-202aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 34.5 kDa
UniProt: P12267
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Klebsiella pneumoniae
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: ADTNVGGGQVNFFGKVTDVSCTVSVNGQGSDANVYLSPVTLTEVKAAAADTYLKPKSFTIDVSDCQAADGTKQDDVSKLGVNWTGGNLLAGATAKQQGYLANTEAAGAQNIQLVLSTDNATALTNKIIPGDSTQPKAAGDASAVQDGARFTYYVGYATSTPTTVTTGVVNSYATYEITYQ
Application Notes: Biological Origin: Klebsiella pneumoniae
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Klebsiella pneumoniaemrkA.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Klebsiella pneumoniaemrkA.