Mouse HDT2 protein

Catalog Number: BYT-ORB383353
Article Name: Mouse HDT2 protein
Biozol Catalog Number: BYT-ORB383353
Supplier Catalog Number: orb383353
Alternative Catalog Number: BYT-ORB383353-20,BYT-ORB383353-100,BYT-ORB383353-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: HD-tuins protein 2 Histone deacetylase 2b
This Mouse HDT2 protein spans the amino acid sequence from region 1-306aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 34.3 kDa
UniProt: Q56WH4
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Arabidopsis thaliana (Mouse-ear cress)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MEFWGVAVTPKNATKVTPEEDSLVHISQASLDCTVKSGESVVLSVTVGGAKLVIGTLSQDKFPQISFDLVFDKEFELSHSGTKANVHFIGYKSPNIEQDDFTSSDDEDVPEAVPAPAPTAVTANGNAGAAVVKADTKPKAKPAEVKPAEEKPESDEEDESDDEDESEEDDDSEKGMDVDEDDSDDDEEEDSEDEEEEETPKKPEPINKKRPNESVSKTPVSGKKAKPAAAPASTPQKTEEKKKGGHTATPHPAKK
Application Notes: Biological Origin: Arabidopsis thaliana (Mouse-ear cress). Application Notes: E.coli and Yeast N-terminal 6xHis-tagged Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.