Human RUNX3 protein

Catalog Number: BYT-ORB383355
Article Name: Human RUNX3 protein
Biozol Catalog Number: BYT-ORB383355
Supplier Catalog Number: orb383355
Alternative Catalog Number: BYT-ORB383355-20,BYT-ORB383355-100,BYT-ORB383355-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Acute myeloid leukemia 2 protein Core-binding factor subunit alpha-3 Short name, CBF-alpha-3
This Human RUNX3 protein spans the amino acid sequence from region 1-415aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 49.4 kDa
UniProt: Q13761
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MRIPVDPSTSRRFTPPSPAFPCGGGGGKMGENSGALSAQAAVGPGGRARPEVRSMVDVLADHAGELVRTDSPNFLCSVLPSHWRCNKTLPVAFKVVALGDVPDGTVVTVMAGNDENYSAELRNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPTQVATYHRAIKVTVDGPREPRRHRQKLEDQTKPFPDRFGDLERLRMRVTPSTPSPRGSLSTTSHFSSQPQTPIQGTSELNPFSDPRQFDRSFPTL
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: E.coli and Yeast N-terminal 10xHis-tagged and C-terminal Myc-tagged Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.