Mouse MSRB7 protein

Catalog Number: BYT-ORB383356
Article Name: Mouse MSRB7 protein
Biozol Catalog Number: BYT-ORB383356
Supplier Catalog Number: orb383356
Alternative Catalog Number: BYT-ORB383356-20,BYT-ORB383356-100,BYT-ORB383356-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Peptide-methionine (R)-S-oxide reductase
This Mouse MSRB7 protein spans the amino acid sequence from region 1-144aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 31.5 kDa
UniProt: Q8VY86
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Arabidopsis thaliana (Mouse-ear cress)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MAAMTAAAVPATGSFQKQDEEWRAVLSPEQFRVLRLKGTDKRGKGEFTKKFEEGTYSCAGCGTALYKSTTKFDSGCGWPAFFDAIPGAIKQTPEAGGRRMEITCAVCDGHLGHVFKGEGYSTPTDQRHCVNSVSLKFSSAGSSQ
Application Notes: Biological Origin: Arabidopsis thaliana (Mouse-ear cress). Application Notes: E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.