Human CST9 protein

Catalog Number: BYT-ORB383360
Article Name: Human CST9 protein
Biozol Catalog Number: BYT-ORB383360
Supplier Catalog Number: orb383360
Alternative Catalog Number: BYT-ORB383360-20,BYT-ORB383360-100,BYT-ORB383360-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Cystatin-like molecule
This Human CST9 protein spans the amino acid sequence from region 29-159aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 18.9 kDa
UniProt: Q5W186
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: WCSEEEMGGNNKIVQDPMFLATVEFALNTFNVQSKEEHAYRLLRVLSSWREDSMDRKWRGKMVFSMNLQLRQTVCRKFEDDIDNCPFQESLELNNVRQGISFPQVHSCGCCMGCGVGTGAADKAIPRDKGK
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: E.coli and Yeast N-terminal 6xHis-tagged Full Length of Mature Protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.