Mouse Lgmn protein
Catalog Number:
BYT-ORB383368
| Article Name: |
Mouse Lgmn protein |
| Biozol Catalog Number: |
BYT-ORB383368 |
| Supplier Catalog Number: |
orb383368 |
| Alternative Catalog Number: |
BYT-ORB383368-20,BYT-ORB383368-100,BYT-ORB383368-1 |
| Manufacturer: |
Biorbyt |
| Category: |
Proteine/Peptide |
| Alternative Names: |
Asparaginyl endopeptidase Protease, cysteine 1 |
| This Mouse Lgmn protein spans the amino acid sequence from region 18-325aa. Purity: Greater than 90% as determined by SDS-PAGE. |
| Molecular Weight: |
38.8 kDa |
| UniProt: |
O89017 |
| Buffer: |
The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. |
| Source: |
Mus musculus (Mouse) |
| Purity: |
Greater than 90% as determined by SDS-PAGE. |
| Form: |
Liquid |
| Sequence: |
VPVGVDDPEDGGKHWVVIVAGSNGWYNYRHQADACHAYQIIHRNGIPDEQIIVMMYDDIANSEENPTPGVVINRPNGTDVYKGVLKDYTGEDVTPENFLAVLRGDAEAVKGKGSGKVLKSGPRDHVFIYFTDHGATGILVFPNDDLHVKDLNKTIRYMYEHKMYQKMVFYIEACESGSMMNHLPDDINVYATTAANPKESSYACYYDEERGTYLGDWYSVNWMEDSDVEDLTKETLHKQYHLVKSHTNTSHVMQY |
| Application Notes: |
Biological Origin: Mus musculus (Mouse). Application Notes: E.coli and Yeast N-terminal 6xHis-tagged Full Length |
![]()
|
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. |
