Bacterial clfA protein

Catalog Number: BYT-ORB383375
Article Name: Bacterial clfA protein
Biozol Catalog Number: BYT-ORB383375
Supplier Catalog Number: orb383375
Alternative Catalog Number: BYT-ORB383375-20,BYT-ORB383375-100,BYT-ORB383375-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Fibrinogen receptor A Fibrinogen-binding protein A
This Bacterial clfA protein spans the amino acid sequence from region 229-559aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 52 kDa
UniProt: Q5HHM8
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Staphylococcus aureus (strain COL)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: GTDITNQLTNVTVGIDSGTTVYPHQAGYVKLNYGFSVPNSAVKGDTFKITVPKELNLNGVTSTAKVPPIMAGDQVLANGVIDSDGNVIYTFTDYVNTKDDVKATLTMPAYIDPENVKKTGNVTLATGIGSTTANKTVLVDYEKYGKFYNLSIKGTIDQIDKTNNTYRQTIYVNPSGDNVIAPVLTGNLKPNTDSNALIDQQNTSIKVYKVDNAADLSESYFVNPENFEDVTNSVNITFPNPNQYKVEFNTPDDQI
Application Notes: Biological Origin: Staphylococcus aureus (strain COL). Application Notes: E.coli and Yeast N-terminal 6xHis-SUMO-tagged Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.