Bacterial groL protein

Catalog Number: BYT-ORB383377
Article Name: Bacterial groL protein
Biozol Catalog Number: BYT-ORB383377
Supplier Catalog Number: orb383377
Alternative Catalog Number: BYT-ORB383377-20,BYT-ORB383377-100,BYT-ORB383377-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: GroEL protein, Protein Cpn60
This Bacterial groL protein spans the amino acid sequence from region 101-548. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 66.9 kDa
UniProt: Q328C4
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Shigella dysenteriae serotype 1 (strain Sd197)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: TEGLKAVAAGMNPMDLKRGIDKAVTAAVEELKALSVPCSDSKAIAQVGTISANSDETVGKLIAEAMDKVGKEGVITVEDGTGLQDELDVVEGMQFDRGYLSPYFINKPETGAVELESPFILLADKKISNIREMLPVLEAVAKAGKPLLIIAEDVEGEALATLVVNTMRGIVKVAAVKAPGFGDRRKAMLQDIATLTGGTVISEEIGMELEKATLEDLGQAKRVVINKDTTTIIDGVGEEAAIQGRVAQIRQQIEE
Application Notes: Biological Origin: Shigella dysenteriae serotype 1 (strain Sd197). Application Notes: E.coli and Yeast N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.