Human CCDC3 protein

Catalog Number: BYT-ORB383380
Article Name: Human CCDC3 protein
Biozol Catalog Number: BYT-ORB383380
Supplier Catalog Number: orb383380
Alternative Catalog Number: BYT-ORB383380-20,BYT-ORB383380-100,BYT-ORB383380-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Fat/vessel-derived secretory protein Short name, Favine
This Human CCDC3 protein spans the amino acid sequence from region 22-270aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 32.1 kDa
UniProt: Q9BQI4
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: CQLPSEWRPLSEGCRAELAETIVYARVLALHPEAPGLYNHLPWQYHAGQGGLFYSAEVEMLCDQAWGSMLEVPAGSRLNLTGLGYFSCHSHTVVQDYSYFFFLRMDENYNLLPHGVNFQDAIFPDTQENRRMFSSLFQFSNCSQGQQLATFSSDWEIQEDSRLMCSSVQKALFEEEDHVKKLQQKVATLEKRNRQLRERVKKVKRSLRQARKKGRHLELANQKLSEKLAAGALPHINARGPVRPPYLRG
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: E.coli and Yeast N-terminal 10xHis-tagged Full Length of Mature Protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.