E. coli mcr1 protein

Catalog Number: BYT-ORB383385
Article Name: E. coli mcr1 protein
Biozol Catalog Number: BYT-ORB383385
Supplier Catalog Number: orb383385
Alternative Catalog Number: BYT-ORB383385-20,BYT-ORB383385-100,BYT-ORB383385-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Polymyxin resistance protein MCR-1
This E. coli mcr1 protein spans the amino acid sequence from region 178-541aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 56.7 kDa
UniProt: A0A0R6L508
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Escherichia coli
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: HYASFFRVHKPLRSYVNPIMPIYSVGKLASIEYKKASAPKDTIYHAKDAVQATKPDMRKPRLVVFVVGETARADHVSFNGYERDTFPQLAKIDGVTNFSNVTSCGTSTAYSVPCMFSYLGADEYDVDTAKYQENVLDTLDRLGVSILWRDNNSDSKGVMDKLPKAQFADYKSATNNAICNTNPYNECRDVGMLVGLDDFVAANNGKDMLIMLHQMGNHGPAYFKRYDEKFAKFTPVCEGNELAKCEHQSLINAYD
Application Notes: Biological Origin: Escherichia coli. Application Notes: E.coli and Yeast N-terminal 6xHis-SUMO-tagged Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.