Human PPP1CB protein

Catalog Number: BYT-ORB383387
Article Name: Human PPP1CB protein
Biozol Catalog Number: BYT-ORB383387
Supplier Catalog Number: orb383387
Alternative Catalog Number: BYT-ORB383387-20,BYT-ORB383387-100,BYT-ORB383387-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: MGC3672, PP 1B , PP-1B, PP1B, PP1B_HUMAN, PP1beta, PPP1CB, PPP1CD, Protein phosphatase 1 beta, Protein phosphatase 1 catalytic subunit beta isoform, Protein phosphatase 1 delta, Protein phosphatase 1, catalytic subunit, beta isozyme, Protein phosphatase 1, catalytic subunit, delta isoform, Serine threonine protein phosphatase PP1 beta catalytic subunit, Serine/threonine-protein phosphatase PP1-beta catalytic subunit
This Human PPP1CB protein spans the amino acid sequence from region 2-327aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 41.1 kDa
UniProt: P62140
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: ADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEF
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: E.coli and Yeast N-terminal 6xHis-tagged Full Length of Mature Protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.