Human ZNF160 protein

Catalog Number: BYT-ORB383388
Article Name: Human ZNF160 protein
Biozol Catalog Number: BYT-ORB383388
Supplier Catalog Number: orb383388
Alternative Catalog Number: BYT-ORB383388-20,BYT-ORB383388-100,BYT-ORB383388-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Zinc finger protein HZF5 Zinc finger protein Kr18 Short name, HKr18
This Human ZNF160 protein spans the amino acid sequence from region 1-147aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 22.1 kDa
UniProt: Q9HCG1
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MALTQVRLTFRDVAIEFSQEEWKCLDPAQRILYRDVMLENYWNLVSLGLCHFDMNIISMLEEGKEPWTVKSCVKIARKPRTPECVKGVVTDLLRRWKHWLLLLGICCPKPHGRVSSRLRLSRSLGHFFHSAFATFMGVCDKRVGSIF
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: E.coli and Yeast N-terminal 10xHis-tagged and C-terminal Myc-tagged Full Length of Isoform 2
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.