Insect alpha 1 Antitrypsin protein

Catalog Number: BYT-ORB383389
Article Name: Insect alpha 1 Antitrypsin protein
Biozol Catalog Number: BYT-ORB383389
Supplier Catalog Number: orb383389
Alternative Catalog Number: BYT-ORB383389-20,BYT-ORB383389-100,BYT-ORB383389-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: anti A1Aprotein, anti A1ATprotein, anti AATprotein, anti Alpha 1 antitrypsinprotein, anti Alpha1ATprotein, anti Dom1protein, anti PI1protein, anti PRO2275protein, anti Serpin A1protein, anti Serpin A1aprotein, anti Serpina1protein, anti Short peptide from AATprotein, anti SPAATprotein, anti Spi1-1protein
This Insect alpha 1 Antitrypsin protein spans the amino acid sequence from region 1-174aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 24.7 kDa
UniProt: P80681
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Tenebrio molitor (Yellow mealworm beetle)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: GLVGAPATLSTAPIAYGGYGGYGAYGGSLLRAAPIARVASPLAYAAPVARVAAPLAYAAPYARAAVAAPVAVAKTVVADEYDPNPQYSFGYDVQDGLTGDSKNQVESRSGDVVQGSYSLVDPDGTRRTVEYTADPINGFNAVVHREPLVAKAVVAAPAIAKVHAPLAYSGGYLH
Application Notes: Biological Origin: Tenebrio molitor (Yellow mealworm beetle). Application Notes: E.coli and Yeast N-terminal 10xHis-B2M-JD-tagged and C-terminal Myc-tagged Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.