Human COPS2 protein

Catalog Number: BYT-ORB383404
Article Name: Human COPS2 protein
Biozol Catalog Number: BYT-ORB383404
Supplier Catalog Number: orb383404
Alternative Catalog Number: BYT-ORB383404-20,BYT-ORB383404-100,BYT-ORB383404-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: anti ALIENprotein, anti Alien Drosophila himolog ofprotein, anti Alien homologprotein, anti COP 9protein, anti COP9protein, anti COP9 constitutive photomorphogenic homolog subunit 2 (Arabidopsis)protein, anti COP9 constitutive photomorphogenic homolog subunit 2protein, anti COP9 signalosome complex subunit 2protein, anti COPS 2protein, anti Cops2protein, anti JAB1 containing signalosome subunit 2protein, anti JAB1-containing signalosome subunit 2protein, anti SGN 2protein, anti SGN2protein, anti Signalosome subunit 2protein, anti Thyroid Hormone Receptor Interactor15protein, anti Thyroid Hormone Receptor Interactor 15protein, anti Thyroid receptor-interacting protein 15protein, anti TR-interacting protein 15protein, anti TRIP 15protein, anti TRIP-15protein, anti TRIP15protein
This Human COPS2 protein spans the amino acid sequence from region 1-443aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 67.6 kDa
UniProt: P61201
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MSDMEDDFMCDDEEDYDLEYSEDSNSEPNVDLENQYYNSKALKEDDPKAALSSFQKVLELEGEKGEWGFKALKQMIKINFKLTNFPEMMNRYKQLLTYIRSAVTRNYSEKSINSILDYISTSKQMDLLQEFYETTLEALKDAKNDRLWFKTNTKLGKLYLEREEYGKLQKILRQLHQSCQTDDGEDDLKKGTQLLEIYALEIQMYTAQKNNKKLKALYEQSLHIKSAIPHPLIMGVIRECGGKMHLREGEFEKAH
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.