Viral prgJ protein

Catalog Number: BYT-ORB383405
Article Name: Viral prgJ protein
Biozol Catalog Number: BYT-ORB383405
Supplier Catalog Number: orb383405
Alternative Catalog Number: BYT-ORB383405-20,BYT-ORB383405-100,BYT-ORB383405-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: prgJ, STM2872Protein PrgJ
This Viral prgJ protein spans the amino acid sequence from region 1-101aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 15.9 kDa
UniProt: P41785
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MSIATIVPENAVIGQAVNIRSMETDIVSLDDRLLQAFSGSAIATAVDKQTITNRIEDPNLVTDPKELAISQEMISDYNLYVSMVSTLTRKGVGAVETLLRS
Application Notes: Biological Origin: Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720). Application Notes: E.coli and Yeast N-terminal 10xHis-tagged and C-terminal Myc-tagged Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.