Rat Cfd protein

Catalog Number: BYT-ORB383410
Article Name: Rat Cfd protein
Biozol Catalog Number: BYT-ORB383410
Supplier Catalog Number: orb383410
Alternative Catalog Number: BYT-ORB383410-20,BYT-ORB383410-100,BYT-ORB383410-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Adipsin C3 convertase activator Endogenous vascular elastase Properdin factor D
This Rat Cfd protein spans the amino acid sequence from region 26-263aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 27.8 kDa
UniProt: P32038
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Rattus norvegicus (Rat)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: ILGGQEAMAHARPYMASVQVNGTHVCGGTLVDEQWVLSAAHCMDGVTKDEVVQVLLGAHSLSSPEPYKHLYDVQSVVLHPGSRPDSVEDDLMLFKLSHNASLGPHVRPLPLQREDREVKPGTLCDVAGWGVVTHAGRRPDVLQQLTVSIMDRNTCNLRTYHDGAITKNMMCAESNRRDTCRGDSGGPLVCGDAVEAVVTWGSRVCGNRRKPGVFTRVATYVPWIENVLSGNVSVNVTA
Application Notes: Biological Origin: Rattus norvegicus (Rat). Application Notes: E.coli and Yeast N-terminal 6xHis-tagged Full Length of Mature Protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.