Bacterial p46 protein

Catalog Number: BYT-ORB383411
Article Name: Bacterial p46 protein
Biozol Catalog Number: BYT-ORB383411
Supplier Catalog Number: orb383411
Alternative Catalog Number: BYT-ORB383411-20,BYT-ORB383411-100,BYT-ORB383411-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: p46
This Bacterial p46 protein spans the amino acid sequence from region 28-416aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 44.5 kDa
UniProt: P0C0J7
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mesomycoplasma hyopneumoniae (strain 232)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: CGQTESGSTSDSKPQAETLKHKVSNDSIRIALTDPDNPRWISAQKDIISYVDETEAATSTITKNQDAQNNWLTQQANLSPAPKGFIIAPENGSGVGTAVNTIADKGIPIVAYDRLITGSDKYDWYVSFDNEKVGELQGLSLAAGLLGKEDGAFDSIDQMNEYLKSHMPQETISFYTIAGSQDDNNSQYFYNGAMKVLKELMKNSQNKIIDLSPEGENAVYVPGWNYGTAGQRIQSFLTINKDPAGGNKIKAVGSK
Application Notes: Biological Origin: Mesomycoplasma hyopneumoniae (strain 232). Application Notes: E.coli and Yeast N-terminal 10xHis-tagged Full Length of Mature Protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.