Fish Parvalbumin beta-1 protein

Catalog Number: BYT-ORB383415
Article Name: Fish Parvalbumin beta-1 protein
Biozol Catalog Number: BYT-ORB383415
Supplier Catalog Number: orb383415
Alternative Catalog Number: BYT-ORB383415-20,BYT-ORB383415-100,BYT-ORB383415-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Allergen, The c 1
This Fish Parvalbumin beta-1 protein spans the amino acid sequence from region 2-109aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 31.4 kDa
UniProt: Q90YK8
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Theragra chalcogramma (Alaska pollock) (Gadus chalcogrammus)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: SFAGVLADADVKAALAGCAAADSFNYKTFFKACGLAAKSHEEVKKAFFVIDQDQSGFIEEDELKLFLQTFGAGARELTAAETKAFLAAGDEDGDGMIGVDEFVTLVKA
Application Notes: Biological Origin: Theragra chalcogramma (Alaska pollock) (Gadus chalcogrammus). Application Notes: E.coli and Yeast N-terminal 10xHis-sumo-tagged and C-terminal Myc-tagged Full Length of Mature Protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.