Fish Renilla-luciferin 2-monooxygenase protein

Catalog Number: BYT-ORB383423
Article Name: Fish Renilla-luciferin 2-monooxygenase protein
Biozol Catalog Number: BYT-ORB383423
Supplier Catalog Number: orb383423
Alternative Catalog Number: BYT-ORB383423-20,BYT-ORB383423-100,BYT-ORB383423-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Renilla-type luciferase
This Fish Renilla-luciferin 2-monooxygenase protein spans the amino acid sequence from region 1-311aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 56 kDa
UniProt: P27652
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Renilla reniformis (Sea pansy)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MTSKVYDPEQRKRMITGPQWWARCKQMNVLDSFINYYDSEKHAENAVIFLHGNAASSYLWRHVVPHIEPVARCIIPDLIGMGKSGKSGNGSYRLLDHYKYLTAWFELLNLPKKIIFVGHDWGACLAFHYSYEHQDKIKAIVHAESVVDVIESWDEWPDIEEDIALIKSEEGEKMVLENNFFVETMLPSKIMRKLEPEEFAAYLEPFKEKGEVRRPTLSWPREIPLVKGGKPDVVQIVRNYNAYLRASDDLPKMFI
Application Notes: Biological Origin: Renilla reniformis (Sea pansy). Application Notes: E.coli and Yeast N-terminal 10xHis-sumo-tagged and C-terminal Myc-tagged Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.