Human CHI3L1 protein
Catalog Number:
BYT-ORB383424
- Images (3)
| Article Name: | Human CHI3L1 protein |
| Biozol Catalog Number: | BYT-ORB383424 |
| Supplier Catalog Number: | orb383424 |
| Alternative Catalog Number: | BYT-ORB383424-20,BYT-ORB383424-100,BYT-ORB383424-1 |
| Manufacturer: | Biorbyt |
| Category: | Proteine/Peptide |
| Alternative Names: | 39KDA synovial protein Cartilage glycoprotein 39 |
| This Human CHI3L1 protein spans the amino acid sequence from region 22-383aa. Purity: Greater than 90% as determined by SDS-PAGE. |
| Molecular Weight: | 60.5 kDa |
| UniProt: | P36222 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Homo sapiens (Human) |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | YKLVCYYTSWSQYREGDGSCFPDALDRFLCTHIIYSFANISNDHIDTWEWNDVTLYGMLNTLKNRNPNLKTLLSVGGWNFGSQRFSKIASNTQSRRTFIKSVPPFLRTHGFDGLDLAWLYPGRRDKQHFTTLIKEMKAEFIKEAQPGKKQLLLSAALSAGKVTIDSSYDIAKISQHLDFISIMTYDFHGAWRGTTGHHSPLFRGQEDASPDRFSNTDYAVGYMLRLGAPASKLVMGIPTFGRSFTLASSETGVGA |
| Application Notes: | Biological Origin: Homo sapiens (Human). Application Notes: E.coli and Yeast N-terminal 10xHis-sumo-tagged and C-terminal Myc-tagged Full Length of Mature Protein |



