Human SIGLEC15 protein

Catalog Number: BYT-ORB383440
Article Name: Human SIGLEC15 protein
Biozol Catalog Number: BYT-ORB383440
Supplier Catalog Number: orb383440
Alternative Catalog Number: BYT-ORB383440-20,BYT-ORB383440-100,BYT-ORB383440-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Sialic acid-binding Ig-like lectin 15, Siglec-15, CD33 antigen-like 3, SIGLEC15, CD33L3
This Human SIGLEC15 protein spans the amino acid sequence from region 20-263aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 30.7 kDa
UniProt: Q6ZMC9
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Lyophilized powder
Sequence: FVRTKIDTTENLLNTEVHSSPAQRWSMQVPPEVSAEAGDAAVLPCTFTHPHRHYDGPLTAIWRAGEPYAGPQVFRCAAARGSELCQTALSLHGRFRLLGNPRRNDLSLRVERLALADDRRYFCRVEFAGDVHDRYESRHGVRLHVTAAPRIVNISVLPSPAHAFRALCTAEGEPPPALAWSGPALGNSLAAVRSPREGHGHLVTAELPALTHDGRYTCTAANSLGRSEASVYLFRFHGASGAST
Application Notes: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA.Immobilized Human SIGLEC15 at 5 µg/mL can bind Anti-SIGLEC15 recombinant antibody(CSB-RA761623MA3HU). The EC50 is 12.42-16.08 ng/mL. Application Notes: Baculovirus and Mammalian Cell N-terminal 6xHis-tagged and Flag-tagged Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.