Bacterial nfuA protein

Catalog Number: BYT-ORB383456
Article Name: Bacterial nfuA protein
Biozol Catalog Number: BYT-ORB383456
Supplier Catalog Number: orb383456
Alternative Catalog Number: BYT-ORB383456-20,BYT-ORB383456-100,BYT-ORB383456-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: nfuA, VV1_0864, Fe/S biogenesis protein NfuA
This Bacterial nfuA protein spans the amino acid sequence from region 1-194aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 47 kDa
UniProt: Q8DDU2
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Vibrio vulnificus (strain CMCP6)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MSNITITEAAQTHFANLLGQQPDGTNIRVFVVNPGTQNAECGVSYCPPEAVEATDTEIPYQSFSAYVDELSLPFLEDAEIDYVTDKMGSQLTLKAPNAKMRKVADDAPLLERVEYAIQTQVNPQLAGHGGHVKLMEITDAGVAIVAFGGGCNGCSMVDVTLKEGIEKELLQQFSGELTAVRDATEHDRGDHSYY
Application Notes: Biological Origin: Vibrio vulnificus (strain CMCP6). Application Notes: Baculovirus and Mammalian Cell N-terminal FC-tagged Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.