Bacterial uspA protein

Catalog Number: BYT-ORB383457
Article Name: Bacterial uspA protein
Biozol Catalog Number: BYT-ORB383457
Supplier Catalog Number: orb383457
Alternative Catalog Number: BYT-ORB383457-20,BYT-ORB383457-100,BYT-ORB383457-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: uspA, STY4212, t3925, Universal stress protein A
This Bacterial uspA protein spans the amino acid sequence from region 2-144aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 19.9 kDa
UniProt: Q8Z268
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Salmonella typhi
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: AYKHILIAVDLSPESKVLVEKAVSMARPYNAKISLIHVDVNYSDLYTGLIDVNLGDMQKRISKETHHALTELSTNAGYPITETLSGSGDLGQVLVDAIKKYDMDLVVCGHHQDFWSKLMSSARQLINTVHVDMLIVPLRDEEE
Application Notes: Biological Origin: Salmonella typhi. Application Notes: Baculovirus and Mammalian Cell N-terminal 6xHis-tagged Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.