Human PAEP protein

Catalog Number: BYT-ORB383467
Article Name: Human PAEP protein
Biozol Catalog Number: BYT-ORB383467
Supplier Catalog Number: orb383467
Alternative Catalog Number: BYT-ORB383467-20,BYT-ORB383467-100,BYT-ORB383467-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Placental protein 14 Short name, PP14
This Human PAEP protein spans the amino acid sequence from region 19-180aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 23.9 kDa
UniProt: P09466
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MDIPQTKQDLELPKLAGTWHSMAMATNNISLMATLKAPLRVHITSLLPTPEDNLEIVLHRWENNSCVEKKVLGEKTENPKKFKINYTVANEATLLDTDYDNFLFLCLQDTTTPIQSMMCQYLARVLVEDDEIMQGFIRAFRPLPRHLWYLLDLKQMEEPCRF
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: Baculovirus and Mammalian Cell N-terminal 10xHis-tagged and C-terminal Myc-tagged Full Length of Mature Protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.