Human DPYSL5 protein

Catalog Number: BYT-ORB418695
Article Name: Human DPYSL5 protein
Biozol Catalog Number: BYT-ORB418695
Supplier Catalog Number: orb418695
Alternative Catalog Number: BYT-ORB418695-20,BYT-ORB418695-100,BYT-ORB418695-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: CRMP3-associated molecule
This Human DPYSL5 protein spans the amino acid sequence from region 1-564aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molecular Weight: 66.4 kDa
UniProt: Q9BPU6
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MLANSASVRILIKGGKVVNDDCTHEADVYIENGIIQQVGRELMIPGGAKVIDATGKLVIPGGIDTSTHFHQTFMNATCVDDFYHGTKAALVGGTTMIIGHVLPDKETSLVDAYEKCRGLADPKVCCDYALHVGITWWAPKVKAEMETLVREKGVNSFQMFMTYKDLYMLRDSELYQVLHACKDIGAIARVHAENGELVAEGAKEALDLGITGPEGIEISRPEELEAEATHRVITIANRTHCPIYLVNVSSISAGD
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-taggedExpression Region: 1-564aaSequence Info: Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.