Viral Small delta antigen protein

Catalog Number: BYT-ORB418698
Article Name: Viral Small delta antigen protein
Biozol Catalog Number: BYT-ORB418698
Supplier Catalog Number: orb418698
Alternative Catalog Number: BYT-ORB418698-20,BYT-ORB418698-100,BYT-ORB418698-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: p24
This Viral Small delta antigen protein spans the amino acid sequence from region 1-195aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molecular Weight: 25.4 kDa
UniProt: P06934
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Hepatitis delta virus genotype I (isolate Italian) (HDV)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MSRSESRKNRGGREEILEQWVAGRKKLEELERDLRKTKKKLKKIEDENPWLGNIKGILGKKDKDGEGAPPAKRARTDQMEVDSGPRKRPLRGGFTDKERQDHRRRKALENKKKQLSAGGKNLSKEEEEELRRLTEEDERRERRVAGPPVGGVIPLEGGSRGAPGGGFVPSLQGVPESPFSRTGEGLDIRGNRGFP
Application Notes: Biological Origin: Hepatitis delta virus genotype I (isolate Italian) (HDV). Application Notes: Tag Info: N-terminal 6xHis-tagged and C-terminal Myc-taggedExpression Region: 1-195aaSequence Info: Full Length of Mature Protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.