Human SELE (HEK) Protein

Catalog Number: BYT-ORB428367
Article Name: Human SELE (HEK) Protein
Biozol Catalog Number: BYT-ORB428367
Supplier Catalog Number: orb428367
Alternative Catalog Number: BYT-ORB428367-1,BYT-ORB428367-10,BYT-ORB428367-2
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: E-selectin, Endothelial leukocyte adhesion molecule 1, ELAM-1, Leukocyte-endothelial cell adhesion molecule 2, LECAM2, CD62E antigen, SELE, ELAM1, ELAM, ESEL, CD62E.
Recombinant of human SELE (HEK) protein
Buffer: SELE was lyophilized from a 0.2 µM filtered solution of PBS and 4% Mannitol, pH 7.5.
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence: WSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGF
Application Notes: Solubility: It is recommended to reconstitute the lyophilized SELE in 1xPBS to a concentration no less than 100 µg/ml, which can then be further diluted to other aqueous solutions. Application Notes: Recombinant & Natural Proteins