Human SPARC Protein

Catalog Number: BYT-ORB428565
Article Name: Human SPARC Protein
Biozol Catalog Number: BYT-ORB428565
Supplier Catalog Number: orb428565
Alternative Catalog Number: BYT-ORB428565-1,BYT-ORB428565-10,BYT-ORB428565-50
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Osteonectin, ON, Basement-membrane protein 40, BM-40, SPARC, Secreted Protein acidic and Rich in Cysteine.
Recombinant of human SPARC protein
Buffer: The SPARC (1 mg/ml) was lyophilized after extensive dialyses against 20mM PBS pH-7.4.
Purity: Greater than 95.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
Form: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence: MSYYHHHHHHPQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEH
Application Notes: Solubility: It is recommended to reconstitute the lyophilized SPARC in sterile 18MO-cm H2O not less than 100 µg/ml, which can then be further diluted to other aqueous solutions. Application Notes: Recombinant & Natural Proteins