Viral VACWR062 protein

Catalog Number: BYT-ORB54130
Article Name: Viral VACWR062 protein
Biozol Catalog Number: BYT-ORB54130
Supplier Catalog Number: orb54130
Alternative Catalog Number: BYT-ORB54130-20,BYT-ORB54130-100,BYT-ORB54130-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: VACWR062, E6RProtein E6
This Viral VACWR062 protein spans the amino acid sequence from region 1-567aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 82.7 kDa
UniProt: P21607
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR))
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MDFIRRKYLIYTVENNIDFLKDDTLSKVNNFTLNHVLALKYLVSNFPQHVITKDVLANTNFFVFIHMVRCCKVYEAVLRHAFDAPTLYVKALTKNYLSFSNTIQSYKETVHKLTQDEKFLEVAKYMDELGELIGVNYDLVLNPLFHGGEPIKDMEIIFLKLFKKTDFKVVKKLSVIRLLIWAYLSKKDTGIEFADNDRQDIYTLFQQTGRIVHSNLTETFRDYIFPGDKTSYWVWLNESIANDADIVLNRHAITM
Application Notes: Biological Origin: Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR)). Application Notes: N-terminal 6xHis-SUMO-tagged: N-terminal 6xHis-SUMO-tagged26-325AA: 1-567AAFull Length: Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CIP 106301 / E264) VACWR062.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CIP 106301 / E264) VACWR062.