Animal Anemonia sulcata Delta-actitoxin-Avd1c protein
Catalog Number:
BYT-ORB54159
- Images (3)
| Article Name: | Animal Anemonia sulcata Delta-actitoxin-Avd1c protein |
| Biozol Catalog Number: | BYT-ORB54159 |
| Supplier Catalog Number: | orb54159 |
| Alternative Catalog Number: | BYT-ORB54159-20,BYT-ORB54159-100,BYT-ORB54159-1 |
| Manufacturer: | Biorbyt |
| Category: | Proteine/Peptide |
| Alternative Names: | ATX-II |
| This Animal Anemonia sulcata Delta-actitoxin-Avd1c protein spans the amino acid sequence from region 1-47aa. Purity: Greater than 90% as determined by SDS-PAGE. |
| Molecular Weight: | 6.9 kDa |
| UniProt: | P01528 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Anemonia sulcata (Mediterranean snakelocks sea anemone) |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | GVPCLCDSDGPSVRGNTLSGIIWLAGCPSGWHNCKKHGPTIGWCCKQ |
| Application Notes: | Biological Origin: Anemonia sulcata (Mediterranean snakelocks sea anemone). Application Notes: N-terminal 6xHis-tagged: N-terminal 6xHis-tagged1-57AA: 1-47AAFull Length: Full Length |
|
|
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. |
|
|
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Anemonia sulcata (Mediterranean snakelocks sea anemone) Delta-actitoxin-Avd1c. |
|
|
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Anemonia sulcata (Mediterranean snakelocks sea anemone) Delta-actitoxin-Avd1c. |
Product Guarantee and Expert Support
