Fungi DOG1 protein

Catalog Number: BYT-ORB54164
Article Name: Fungi DOG1 protein
Biozol Catalog Number: BYT-ORB54164
Supplier Catalog Number: orb54164
Alternative Catalog Number: BYT-ORB54164-20,BYT-ORB54164-100,BYT-ORB54164-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: DOG1, YHR044C2-deoxyglucose-6-phosphate phosphatase 1, 2-DOG-6-P 1, 2-deoxyglucose-6-phosphatase 1, EC 3.1.3.68
This Fungi DOG1 protein spans the amino acid sequence from region 1-246aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 29.1 kDa
UniProt: P38774
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MAEFSADLCLFDLDGTIVSTTVAAEKAWTKLCYEYGVDPSELFKHSHGARTQEVLRRFFPKLDDTDNKGVLALEKDIAHSYLDTVSLIPGAENLLLSLDVDTETQKKLPERKWAIVTSGSPYLAFSWFETILKNVGKPKVFITGFDVKNGKPDPEGYSRARDLLRQDLQLTGKQDLKYVVFEDAPVGIKAGKAMGAITVGITSSYDKSVLFDAGADYVVCDLTQVSVVKNNENGIVIQVNNPLTRA
Application Notes: Biological Origin: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast). Application Notes: N-terminal 6xHis-tagged: N-terminal 6xHis-tagged37-193AA: 1-246AAFull Length: Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast) DOG1.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast) DOG1.