Human DGKA protein

Catalog Number: BYT-ORB54170
Article Name: Human DGKA protein
Biozol Catalog Number: BYT-ORB54170
Supplier Catalog Number: orb54170
Alternative Catalog Number: BYT-ORB54170-20,BYT-ORB54170-100,BYT-ORB54170-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: 80KDA diacylglycerol kinase Diglyceride kinase alpha
This Human DGKA protein spans the amino acid sequence from region 1-735aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 86.6 kDa
UniProt: P23743
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MAKERGLISPSDFAQLQKYMEYSTKKVSDVLKLFEDGEMAKYVQGDAIGYEGFQQFLKIYLEVDNVPRHLSLALFQSFETGHCLNETNVTKDVVCLNDVSCYFSLLEGGRPEDKLEFTFKLYDTDRNGILDSSEVDKIILQMMRVAEYLDWDVSELRPILQEMMKEIDYDGSGSVSQAEWVRAGATTVPLLVLLGLEMTLKDDGQHMWRPKRFPRPVYCNLCESSIGLGKQGLSCNLCKYTVHDQCAMKALPCEV
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: N-terminal 6XHis-SUMO-tagged: N-terminal 6XHis-tagged1-152AA: 1-735AAFull Length: Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) DGKA.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) DGKA.