Bacterial lasA protein
Catalog Number:
BYT-ORB54187
- Images (3)
| Article Name: | Bacterial lasA protein |
| Biozol Catalog Number: | BYT-ORB54187 |
| Supplier Catalog Number: | orb54187 |
| Alternative Catalog Number: | BYT-ORB54187-20,BYT-ORB54187-100,BYT-ORB54187-1 |
| Manufacturer: | Biorbyt |
| Category: | Proteine/Peptide |
| Alternative Names: | Staphylolytic protease |
| This Bacterial lasA protein spans the amino acid sequence from region 237-418aa. Purity: Greater than 90% as determined by SDS-PAGE. |
| Molecular Weight: | 36 kDa |
| UniProt: | P14789 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | APPSNLMQLPWRQGYSWQPNGAHSNTGSGYPYSSFDASYDWPRWGSATYSVVAAHAGTVRVLSRCQVRVTHPSGWATNYYHMDQIQVSNGQQVSADTKLGVYAGNINTALCEGGSSTGPHLHFSLLYNGAFVSLQGASFGPYRINVGTSNYDNDCRRYYFYNQSAGTTHCAFRPLYNPGLAL |
| Application Notes: | Biological Origin: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228). Application Notes: N-terminal 10xHis-tagged: N-terminal 6xHis-SUMO-tagged1-76AA: 237-418AAFull Length: Full Length of Mature Protein |
|
|
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. |
|
|
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) lasA. |
|
|
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) lasA. |
Product Guarantee and Expert Support
