Bacterial phr protein
Catalog Number:
BYT-ORB54213
- Images (3)
| Article Name: | Bacterial phr protein |
| Biozol Catalog Number: | BYT-ORB54213 |
| Supplier Catalog Number: | orb54213 |
| Alternative Catalog Number: | BYT-ORB54213-20,BYT-ORB54213-100,BYT-ORB54213-1 |
| Manufacturer: | Biorbyt |
| Category: | Proteine/Peptide |
| Alternative Names: | DNA photolyase Photoreactivating enzyme |
| This Bacterial phr protein spans the amino acid sequence from region 2-484aa. Purity: Greater than 90% as determined by SDS-PAGE. |
| Molecular Weight: | 74.3 kDa |
| UniProt: | P05327 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) (Anacystis nidulans) |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | AAPILFWHRRDLRLSDNIGLAAARAQSAQLIGLFCLDPQILQSADMAPARVAYLQGCLQELQQRYQQAGSRLLLLQGDPQHLIPQLAQQLQAEAVYWNQDIEPYGRDRDGQVAAALKTAGIRAVQLWDQLLHSPDQILSGSGNPYSVYGPFWKNWQAQPKPTPVATPTELVDLSPEQLTAIAPLLLSELPTLKQLGFDWDGGFPVEPGETAAIARLQEFCDRAIADYDPQRNFPAEAGTSGLSPALKFGAIGIRQ |
| Application Notes: | Biological Origin: Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) (Anacystis nidulans). Application Notes: N-terminal 6xHis-tagged: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged131-362AA: 2-484AAPartial: Full Length of Mature Protein |
|
|
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. |
|
|
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) (Anacystis nidulans) phr. |
|
|
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) (Anacystis nidulans) phr. |
Product Guarantee and Expert Support
